Iright
BRAND / VENDOR: Proteintech

Proteintech, 87319-1-RR, UBC9 Recombinant monoclonal antibody

CATALOG NUMBER: 87319-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The UBC9 (87319-1-RR) by Proteintech is a Recombinant antibody targeting UBC9 in WB, ELISA applications with reactivity to human, mouse, rat samples 87319-1-RR targets UBC9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cellls, Jurkat cellls, NIH/3T3 cellls, PC-12 cellls, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information UBC9 is also named as UBE2I, UBCE9 and belongs to the ubiquitin-conjugating enzyme family. It is a homologue of the E2 ubiquitin conjugating enzyme and participates in the covalent linking of SUMO-1 molecule to the target protein. This protein is present at a high level in spleen and lung. Moderate level of UBC9 is detected in kidney and liver. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0111 Product name: Recombinant human UBC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC004437 Sequence: VPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYWLVAALAPLVAAPPRPSQGRLAGREWSTQAHPRDSQGPRLC Predict reactive species Full Name: ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC004437 Gene Symbol: UBC9 Gene ID (NCBI): 7329 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P63279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924