Iright
BRAND / VENDOR: Proteintech

Proteintech, 87334-1-RR, MYOT Recombinant monoclonal antibody

CATALOG NUMBER: 87334-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MYOT (87334-1-RR) by Proteintech is a Recombinant antibody targeting MYOT in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 87334-1-RR targets MYOT in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue, pig skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MYOT (myotilin) is a structural protein of the striated muscle Z-discs. It interacts with both actinin and filamin, forming a complex to maintain structural stability of muscles. In adult tissues, myotilin is mainly expressed in skeletal and cardiac muscles and in the peripheral nerves. Missense mutations of myotilin cause limb girdle muscular dystrophy 1A and some other myopathy. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6068 Product name: Recombinant human MYOTI protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-498 aa of / Sequence: MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPKQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL Predict reactive species Full Name: myotilin Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55-57 kDa GenBank Accession Number: / Gene Symbol: MYOT Gene ID (NCBI): 9499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UBF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924