Iright
BRAND / VENDOR: Proteintech

Proteintech, 87341-1-RR, SPATA6 Recombinant monoclonal antibody

CATALOG NUMBER: 87341-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SPATA6 (87341-1-RR) by Proteintech is a Recombinant antibody targeting SPATA6 in WB, ELISA applications with reactivity to human, mouse samples 87341-1-RR targets SPATA6 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Spermatogenesis-associated protein 6 (SPATA6) is a testis-enriched protein crucial for spermatogenesis and male fertility. It localizes to the sperm head-tail coupling apparatus (HTCA) and is crucial for the proper assembly of the sperm connecting piece and tight head-tail conjunction. SPATA6 is a core structural component of the sperm fibrous sheath (FS), a cytoskeletal structure in the principal piece of the sperm flagellum essential for normal sperm motility. Mutations in SPATA6 can lead to acephalic spermatozoa and male infertility (PMID: 38454159, PMID: 41058548). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag41247 Product name: Recombinant human SPATA6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 167-472 aa of BC020660 Sequence: YHLAPVEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHVDPPSPRADTLLGSSGRDCERDGWSRVHNDHSHLGCCRPKDYKVIRTPHGRDFDDSLEKCEEYLSPRSCSKPRHSARTLLVHSAPSTMPKHSPSPVLNRASLRERFHSDWCSPSNCDEIHDRDERDLEKDDELELKRSLLCRDSAYDSDPEYSSCQQPRGTFHLDDGEYWSNRAASYKGKSHRPIFENSMDKMYRNLYKKACSSASHTQESF Predict reactive species Full Name: spermatogenesis associated 6 Calculated Molecular Weight: 472 aa, 54 kDa Observed Molecular Weight: 54-60 kDa GenBank Accession Number: BC020660 Gene Symbol: SPATA6 Gene ID (NCBI): 54558 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NWH7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924