Iright
BRAND / VENDOR: Proteintech

Proteintech, 87375-1-RR, MSMB Recombinant monoclonal antibody

CATALOG NUMBER: 87375-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MSMB (87375-1-RR) by Proteintech is a Recombinant antibody targeting MSMB in WB, ELISA applications with reactivity to human samples 87375-1-RR targets MSMB in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human urine sample Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MSMB is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in the uterus, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8674 Product name: Recombinant human MSMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC005257 Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII Predict reactive species Full Name: microseminoprotein, beta- Calculated Molecular Weight: 114 aa, 13 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC005257 Gene Symbol: MSMB Gene ID (NCBI): 4477 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08118 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924