Proteintech, 87382-2-RR, Integrin alpha 6 Recombinant monoclonal antibody

Size: 20ul / 100ul The Integrin alpha 6 (87382-2-RR) by Proteintech is a Recombinant antibody targeting Integrin alpha 6 in WB, ELISA applications with reactivity to mouse, rat samples 87382-2-RR targets Integrin alpha 6 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse lung tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg10470 Product name: Recombinant mouse ITA6 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-Twin-Strep-Tag Domain: 465-1011 aa of Q61739-1 Sequence: RPVINILKTITVTPNRIDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKGIPELVLKDQKDIALEITVTNSPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQIVCEPHNEINYLKLKESHNSRKKRELPEKQIDDSRKFSLFPERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNSTFLEEYSKLNYLDILLRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYS Predict reactive species Full Name: integrin alpha 6 Observed Molecular Weight: 120 kDa GenBank Accession Number: Q61739-1 Gene Symbol: Itga6 Gene ID (NCBI): 16403 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.