Iright
BRAND / VENDOR: Proteintech

Proteintech, 87384-1-RR, DPEP1 Recombinant monoclonal antibody

CATALOG NUMBER: 87384-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DPEP1 (87384-1-RR) by Proteintech is a Recombinant antibody targeting DPEP1 in WB, ELISA applications with reactivity to human samples 87384-1-RR targets DPEP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DPEP1(Dipeptidase 1) is also named as MDP, RDP and belongs to the peptidase M19 family. It is a glycoprotein that plays an important role in the regulation of leukotriene activity. DPEP1 converts lekotriene D4 to leukotriene E4. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5510 Product name: Recombinant human DPEP1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 17-385 aa of NM_001128141.3 Sequence: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS Predict reactive species Full Name: dipeptidase 1 (renal) Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: NM_001128141.3 Gene Symbol: DPEP1 Gene ID (NCBI): 1800 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16444 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924