Iright
BRAND / VENDOR: Proteintech

Proteintech, 87389-1-RR, ABHD14B Recombinant monoclonal antibody

CATALOG NUMBER: 87389-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ABHD14B (87389-1-RR) by Proteintech is a Recombinant antibody targeting ABHD14B in WB, ELISA applications with reactivity to human, mouse samples 87389-1-RR targets ABHD14B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, mouse liver tissue, HepG2 cells, mouse small intestine tissue, mouse colon tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ABHD14B possessed the canonical ABHD fold, an invariant catalytic triad (Ser-His-Asp), and based on its protein sequence, was subsequently categorized as an outlying member of the metabolic serine hydrolase family. ABHD14B was able to transfer an acetyl group from post translationally modified protein lysine residue to coenzyme-A (CoA), thus making the biologically important acetyl-CoA. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15097 Product name: Recombinant human ABHD14B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC007234 Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ Predict reactive species Full Name: abhydrolase domain containing 14B Calculated Molecular Weight: 210 aa, 22 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC007234 Gene Symbol: ABHD14B Gene ID (NCBI): 84836 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96IU4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924