Proteintech, 87403-1-RR, Ly-6A/E (Sca-1) Recombinant monoclonal antibody

Size: 20ul / 100ul The Ly-6A/E (Sca-1) (87403-1-RR) by Proteintech is a Recombinant antibody targeting Ly-6A/E (Sca-1) in WB, ELISA applications with reactivity to mouse samples 87403-1-RR targets Ly-6A/E (Sca-1) in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: C2C12 cells, mouse bone marrow tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The lymphocyte antigen 6 (Ly-6) supergene family encodes proteins of 12-14 kda in molecular mass that are either secreted or anchored to the plasma membrane through a glycosyl-phosphatidylinisotol (GPI) lipid anchor at the carboxy-terminus. Mouse Ly-6A, also known as Sca-1 (Stem cell antigen 1), is a GPI-anchored membrane protein and the prototypic member of the lymphocyte antigen 6 (Ly-6) supergene family. These proteins were first described as allo-antigens expressed on activated murine lymphocytes (PMID: 28660664). Ly-6A/E (Sca-1) is expressed in activated lymphocytes, hematopoietic stem cells and stem cells of a variety of tissues in mice (PMID: 24586463). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4270 Product name: recombinant mouse Ly6a protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-112 aa of NM_001271416.1 Sequence: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG Predict reactive species Full Name: lymphocyte antigen 6 complex, locus A Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-18 kDa GenBank Accession Number: NM_001271416.1 Gene Symbol: Ly6a Gene ID (NCBI): 110454 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.