Proteintech, 87425-2-RR, ZFYVE19 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZFYVE19 (87425-2-RR) by Proteintech is a Recombinant antibody targeting ZFYVE19 in WB, ELISA applications with reactivity to human samples 87425-2-RR targets ZFYVE19 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ZFYVE19, also known as ANCHR, is a poorly characterized human protein. Recent clinical studies have linked biallelic loss-of-function mutations to a progressive familial intrahepatic cholestasis (PFIC) phenotype featuring neonatal-onset high-GGT cholestasis, congenital hepatic fibrosis, and sclerosing cholangiopathy. (PMID: 33853651) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19593 Product name: Recombinant human ZFYVE19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-471 aa of BC015738 Sequence: VCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH Predict reactive species Full Name: zinc finger, FYVE domain containing 19 Calculated Molecular Weight: 471 aa, 52 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC015738 Gene Symbol: ZFYVE19 Gene ID (NCBI): 84936 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96K21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.