Proteintech, 87427-1-RR, ACSL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ACSL1 (87427-1-RR) by Proteintech is a Recombinant antibody targeting ACSL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 87427-1-RR targets ACSL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ACSL1(Long-chain-fatty-acid--CoA ligase 1) is also named as FACL1, FACL2, LACS, LACS1, LACS2 and belongs to the ATP-dependent AMP-binding enzyme family. ACSL1 is a 75 kDa protein that is associated peripherally with the plasma membrane(Brian M Wiczer, etc., 2006). ACSL1 is abundantly expressed in tissues, such as liver and brown fat, that metabolize substantial amounts of triglycerides as fuel, and as such, a deficiency in ACSL1 function could have a more profound affect in those cells, resulting in hepatosteatosis and potentially increased very low density lipoprotein production by the liver or decreased thermogenic capacity in brown adipose tissue(PMID:19429676). An anti-rat ACSL1 antibody recognized a band of the predicted 68 kDa in high-speed supernatant from rat liver and in human and murine SMCs, monocyte-derived macrophages, and murine peritoneal macrophages (PMID:17259370). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5059 Product name: Recombinant human ACSL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 349-698 aa of BC050073 Sequence: RLLMDDLKVLQPTVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKVQSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV Predict reactive species Full Name: acyl-CoA synthetase long-chain family member 1 Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC050073 Gene Symbol: ACSL1 Gene ID (NCBI): 2180 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P33121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.