Iright
BRAND / VENDOR: Proteintech

Proteintech, 87434-1-RR, POFUT1 Recombinant monoclonal antibody

CATALOG NUMBER: 87434-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The POFUT1 (87434-1-RR) by Proteintech is a Recombinant antibody targeting POFUT1 in WB, ELISA applications with reactivity to human samples 87434-1-RR targets POFUT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HepG2 cells, HUVEC cells, PANC-1 cells, JAR cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information POFUT1 (protein O-fucosyltransferase 1), also known as GDP-fucose protein O-fucosyltransferase, is an enzyme that catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains and plays a crucial role in Notch signaling. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6687 Product name: Recombinant human POFUT1/FUT12 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-388 aa of NM_015352.2 Sequence: GSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF Predict reactive species Full Name: protein O-fucosyltransferase 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: NM_015352.2 Gene Symbol: POFUT1 Gene ID (NCBI): 23509 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H488-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924