Iright
BRAND / VENDOR: Proteintech

Proteintech, 87446-1-RR, LYPD8 Recombinant monoclonal antibody

CATALOG NUMBER: 87446-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LYPD8 (87446-1-RR) by Proteintech is a Recombinant antibody targeting LYPD8 in WB, ELISA applications with reactivity to mouse samples 87446-1-RR targets LYPD8 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Ly6/PLAUR domain-containing protein 8 (LYPD8) is a highly glycosylated glycosylphosphatidylinositol-anchored protein, which is anchored to intestinal epithelial cells in the uppermost epithelial layer, is constitutively shed into the intestinal lumen and preferentially binds to flagellated bacteria from various genera (PMID: 27027293; 29259722). It has been reported that Lypd8 mediates the segregation of intestinal bacteria and epithelial cells in the colon, thereby preserving intestinal homeostasis (PMID: 27027293). The higher observed molecular weight of LYPD8 is 75 kDa, due to glycosylation modification (PMID: 29259722). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7518 Product name: Recombinant mouse Lypd8 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-255 aa of NM_001083884.1 Sequence: LNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFLHVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQCMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNTTVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASFTSSIFGSLLLLKLLF Predict reactive species Full Name: RIKEN cDNA 2210415F13 gene Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 75 kDa, 45 kDa GenBank Accession Number: NM_001083884.1 Gene Symbol: 2210415F13Rik Gene ID (NCBI): 70163 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9D7S0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924