Iright
BRAND / VENDOR: Proteintech

Proteintech, 87450-2-RR, Factor XIIIa Recombinant monoclonal antibody

CATALOG NUMBER: 87450-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Factor XIIIa (87450-2-RR) by Proteintech is a Recombinant antibody targeting Factor XIIIa in WB, ELISA applications with reactivity to human, mouse, rat samples 87450-2-RR targets Factor XIIIa in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Factor XIIIa is a blood proenzyme that catalyzes intermolecular cross-linking of fibrinogen and is involved in clotting cascade. It has been identified in various tissues including placenta, uterus, and prostate. Anti- Factor XIIIa has been found to be useful in differentiating between dermatofibroma (90% positive) and desmoplastic malignant melanoma (negative). Factor XIIIa positivity is also seen in capillary hemagioblastoma, hemangioendothelioma, hemangiopericytoma, xanthogranuloma, xanthoma, hepatocellular carcinoma, glomus tumor, and meningioma. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5185 Product name: recombinant human F13A1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 510-732 aa of NM_000129.4 Sequence: EGVMKSRSNVDMDFEVENAVLGKDFKLSITFRNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYGELDVQIQRRPSM Predict reactive species Full Name: coagulation factor XIII, A1 polypeptide Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 80~85 kDa GenBank Accession Number: NM_000129.4 Gene Symbol: Factor XIIIa Gene ID (NCBI): 2162 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924