Proteintech, 87485-1-RR, IL-27A p28 Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-27A p28 (87485-1-RR) by Proteintech is a Recombinant antibody targeting IL-27A p28 in WB, ELISA applications with reactivity to rat samples 87485-1-RR targets IL-27A p28 in WB, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat spleen tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information IL-27, as a member of the IL-6/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6264 Product name: Recombinant rat IL27A/IL27 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 29-234 aa of / Sequence: FPADPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPVGHHLPNVSLTFQAWRHLSDSDRLCFLATTLRPFPALLGGLETQRTWTSSEREQLWAMRLDLRDLHRHLRFQVLAVGFSCSEEEKEEEEEDEEEEEGKELLLGALGGPNQVSSQVSWPQLLYAYQLLHSLELVLSRAVRDLLLLSLPRRPDSACDP Predict reactive species Full Name: interleukin 27 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: / Gene Symbol: Il27 Gene ID (NCBI): 365368 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A6I997 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.