Proteintech, 87538-2-RR, KLRA8 Recombinant monoclonal antibody

Size: 20ul / 100ul The KLRA8 (87538-2-RR) by Proteintech is a Recombinant antibody targeting KLRA8 in WB, ELISA applications with reactivity to mouse samples 87538-2-RR targets KLRA8 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue, mouse spleen tissue, mouse kidney tissue, mouse bone marrow tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6366 Product name: Recombinant mouse Ly-49H protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 67-266 aa of NM_001101620.1 Sequence: KFFQYSQHKQEINETLNHRHNCSNMQRDFNLKEEMLTNKSIDCRPSYELLEYIKREQERWDSETKSVSDSSRDTGRGVKYWFCYGTKCYYFIMNKTTWSGCKANCQHYSVPIVKIEDEDELKFLQRHVILESYWIGLSYDKKKKEWAWIHNGQSKLDMKIKKMNFTSRGCVFLSKARIEDTDCNTPYYCICGKKLDKFPD Predict reactive species Full Name: killer cell lectin-like receptor, subfamily A, member 8 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_001101620.1 Gene Symbol: Klra8 Gene ID (NCBI): 16639 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q60682-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.