Iright
BRAND / VENDOR: Proteintech

Proteintech, 87585-1-RR, CHRNA9 Recombinant monoclonal antibody

CATALOG NUMBER: 87585-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CHRNA9 (87585-1-RR) by Proteintech is a Recombinant antibody targeting CHRNA9 in WB, ELISA applications with reactivity to human, mouse, rat samples 87585-1-RR targets CHRNA9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse skin tissue, rat skin tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CHRNA9 (nicotinic α9 subunit of cholinergic receptor) gene is located in zone 4 (4p14) of short arm 1 of human chromosome 4, encoding a ligand-gated divalent cation channel protein, belonging to the nicotinic acetylcholine receptor (nAChR) superfamily. This subunit can be combined with CHRNA10 subunit to form a heteropentamer or a homopentamer, which is mainly distributed in cochlear outer hair cells, dorsal root ganglion, keratinocytes and immune cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23272 Product name: Recombinant human CHRNA9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 324-479 aa of BC113549 Sequence: HFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATSSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 9 Calculated Molecular Weight: 479 aa, 55 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC113549 Gene Symbol: CHRNA9 Gene ID (NCBI): 55584 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UGM1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924