Iright
BRAND / VENDOR: Proteintech

Proteintech, 87596-1-RR, TRAF3IP2 Recombinant monoclonal antibody

CATALOG NUMBER: 87596-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRAF3IP2 (87596-1-RR) by Proteintech is a Recombinant antibody targeting TRAF3IP2 in WB, ELISA applications with reactivity to human samples 87596-1-RR targets TRAF3IP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24840 Product name: Recombinant human TRAF3IP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC002823 Sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN Predict reactive species Full Name: TRAF3 interacting protein 2 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC002823 Gene Symbol: TRAF3IP2 Gene ID (NCBI): 10758 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924