Proteintech, 98001-1-RR, Anti-Rat IFN-gamma Rabbit Recombinant Antibody

Size: 100ug The IFN-gamma (98001-1-RR) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra) applications with reactivity to rat samples 98001-1-RR targets IFN-gamma in FC (Intra) applications and shows reactivity with rat samples. Tested Applications Positive FC (Intra) detected in: ConA, PMA and ionomycin stimulated Wistar rat splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427) Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0400 Product name: Recombinant Rat IFN-gamma protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-156 aa of NM_138880 Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC Predict reactive species Full Name: interferon gamma Calculated Molecular Weight: 18 kDa GenBank Accession Number: NM_138880 Gene Symbol: IFN-gamma Gene ID (NCBI): 25712 RRID: AB_3672145 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01581 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.