Proteintech, 98040-1-RR, Anti-Human CD14 Rabbit Recombinant Antibody

Size: 100ug The CD14 (98040-1-RR) by Proteintech is a Recombinant antibody targeting CD14 in FC applications with reactivity to human, monkey, non-human primates samples 98040-1-RR targets CD14 in FC applications and shows reactivity with human, monkey, non-human primates samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS. Specification Tested Reactivity: human, monkey, non-human primates Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0498 Product name: Recombinant human CD14 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-344 aa of BC010507 Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM Predict reactive species Full Name: CD14 molecule Calculated Molecular Weight: 375 aa, 40 kDa GenBank Accession Number: BC010507 Gene Symbol: CD14 Gene ID (NCBI): 929 ENSEMBL Gene ID: ENSG00000170458 RRID: AB_3672187 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P08571 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.