Iright
BRAND / VENDOR: Proteintech

Proteintech, 98080-1-RR, Anti-Mouse PD-1/CD279 Rabbit Recombinant Antibody

CATALOG NUMBER: 98080-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The PD-1/CD279 (98080-1-RR) by Proteintech is a Recombinant antibody targeting PD-1/CD279 in FC, Blocking applications with reactivity to mouse samples 98080-1-RR targets PD-1/CD279 in FC, Blocking applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: anti-CD3/CD28 treated mouse splenocytes Positive Blocking detected in: Recombinant protein Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension BLOCKING: BLOCKING : Background Information Programmed cell death 1 (PD-1, also known as CD279) is an immunoinhibitory receptor that belongs to the CD28/CTLA-4 subfamily of the Ig superfamily. It is a 288 amino acid (aa) type I transmembrane protein composed of one Ig superfamily domain, a stalk, a transmembrane domain, and an intracellular domain containing an immunoreceptor tyrosine-based inhibitory motif (ITIM) as well as an immunoreceptor tyrosine-based switch motif (ITSM) (PMID: 18173375). PD-1 is expressed during thymic development and is induced in a variety of hematopoietic cells in the periphery by antigen receptor signaling and cytokines (PMID: 20636820). Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function (PMID: 19426218). It is critical for the regulation of T cell function during immunity and tolerance. Blockade of PD-1 can overcome immune resistance and also has been shown to have antitumor activity (PMID: 22658127; 23169436). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0918 Product name: Recombinant mouse PD-1 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-167 aa of NM_008798.2 Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ Predict reactive species Full Name: programmed cell death 1 Calculated Molecular Weight: 32 kDa GenBank Accession Number: NM_008798.2 Gene Symbol: PD-1 Gene ID (NCBI): 18566 RRID: AB_3672227 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q02242 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924