Product Description
Size: 100ug
The TWEAKR/CD266 (98125-1-RR) by Proteintech is a Recombinant antibody targeting TWEAKR/CD266 in FC applications with reactivity to human samples
98125-1-RR targets TWEAKR/CD266 in FC applications and shows reactivity with human samples.
Tested Applications
Positive FC detected in: HT-1080 cells
Recommended dilution
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension
Background Information
TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TWEAKR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TWEAKR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species
Full Name: tumor necrosis factor receptor superfamily, member 12A
Calculated Molecular Weight: 129 aa, 14 kDa
GenBank Accession Number: BC002718
Gene Symbol: TWEAKR
Gene ID (NCBI): 51330
RRID: AB_3672272
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: Q9NP84
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924