Iright
BRAND / VENDOR: Proteintech

Proteintech, 98129-1-RR, Anti-Mouse CD79a Rabbit Recombinant Antibody

CATALOG NUMBER: 98129-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD79a (98129-1-RR) by Proteintech is a Recombinant antibody targeting CD79a in FC (Intra) applications with reactivity to mouse samples 98129-1-RR targets CD79a in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cell and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1388 Product name: Recombinant Mouse CD79A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-137 aa of NM_007655.3 Sequence: LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNR Predict reactive species Full Name: CD79A antigen (immunoglobulin-associated alpha) Calculated Molecular Weight: 25 kDa GenBank Accession Number: NM_007655.3 Gene Symbol: Cd79a Gene ID (NCBI): 12518 RRID: AB_3672275 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P11911 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924