Iright
BRAND / VENDOR: Proteintech

Proteintech, 98193-1-RR, Anti-Mouse CD2 Rabbit Recombinant Antibody

CATALOG NUMBER: 98193-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD2 (98193-1-RR) by Proteintech is a Recombinant antibody targeting CD2 in FC applications with reactivity to mouse samples 98193-1-RR targets CD2 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.15 ug per 10^6 cells in 100 μl suspension Background Information CD2 is a cell surface glycoprotein present on a majority of thymocytes, all mature T cells and subset of NK cells but not on B lymphocytes. It is a pan T-cell marker. CD2 interacts with lymphocyte function-associated antigen (LFA-3/CD58) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1403 Product name: Recombinant Mouse CD2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-203 aa of NM_013486.2 Sequence: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS Predict reactive species Full Name: CD2 antigen Calculated Molecular Weight: 38 kDa GenBank Accession Number: NM_013486.2 Gene Symbol: CD2 Gene ID (NCBI): 12481 RRID: AB_3672330 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P08920 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924