Proteintech, 98212-1-RR, Anti-Mouse CD70 Rabbit Recombinant Antibody

Size: 100ug The CD70 (98212-1-RR) by Proteintech is a Recombinant antibody targeting CD70 in FC applications with reactivity to mouse samples 98212-1-RR targets CD70 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: LPS treated mouse splenic leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD70, also known as tumor necrosis factor ligand superfamily member 7 (TNFSF7) or CD27 ligand (CD27L), is a transmembrane protein that plays a significant role in the immune system. It is the unique ligand for CD27, a member of the tumor necrosis factor receptor (TNFR) family, and is transiently upregulated upon stimulation of immune cells. CD70 is expressed on lymphocytes and dendritic cells, and its expression can be regulated by activation signals received via toll-like receptors (TLRs), CD40, and the antigen receptor MHC II. It provides complex and not completely understood signaling for B cell development. CD70 is also expressed on various solid tumors and hematolymphoid malignancies, where it may contribute to a poor prognosis. (PMID: 34991665; 26213107; 26098609) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1294 Product name: recombinant mouse CD70 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 45-195 aa of NM_011617.2 Sequence: SKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP Predict reactive species Full Name: CD70 antigen Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_011617.2 Gene Symbol: Cd70 Gene ID (NCBI): 21948 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O55237 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.