Iright
BRAND / VENDOR: Proteintech

Proteintech, 98241-1-RR, Anti-Mouse PD-L2/CD273 Rabbit Recombinant Antibody

CATALOG NUMBER: 98241-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The PD-L2/CD273 (98241-1-RR) by Proteintech is a Recombinant antibody targeting PD-L2/CD273 in FC applications with reactivity to mouse samples 98241-1-RR targets PD-L2/CD273 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: GM-CSF treated mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Programmed cell death ligand 2 (PD-L2, also known as CD273, or B7-DC), is one of the B7 family molecules which are type I transmembrane proteins belonging to the immunoglobulin superfamily. PD-L2 was identified both by its homology to PD-L1 and by analysis of genes differentially expressed in libraries generated from dendritic cells (DC) and activated macrophages (PMID: 14515254). PD-L2 is a second ligand for PD-1, a costimulatory molecule that plays an inhibitory role in regulating T cell activation in the periphery. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1842 Product name: Recombinant Mouse PD-L2/B7-DC protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-219 aa of NM_021396.2 Sequence: LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR Predict reactive species Full Name: programmed cell death 1 ligand 2 Calculated Molecular Weight: 28kDa GenBank Accession Number: NM_021396.2 Gene Symbol: Pdcd1lg2 Gene ID (NCBI): 58205 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9WUL5 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924