Proteintech, 98247-1-RR, Anti-Human TSLP Rabbit Recombinant Antibody

Size: 100ug The TSLP (98247-1-RR) by Proteintech is a Recombinant antibody targeting TSLP in FC (Intra) applications with reactivity to human samples 98247-1-RR targets TSLP in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: IL-4, TNF-α and BFA treated HUVEC cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1238 Product name: Recombinant Human TSLP protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-159 aa of NM_033035.5 Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species Full Name: thymic stromal lymphopoietin Calculated Molecular Weight: 18 kDa GenBank Accession Number: NM_033035.5 Gene Symbol: TSLP Gene ID (NCBI): 85480 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q969D9-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.