Proteintech, 98263-1-RR, Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody

Size: 100ug The TMIGD2/CD28H (98263-1-RR) by Proteintech is a Recombinant antibody targeting TMIGD2/CD28H in FC applications with reactivity to human samples 98263-1-RR targets TMIGD2/CD28H in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2, also known as CD28H and IGPR1), plays a role in cell-cell interaction, migration, and angiogenesis. Through interaction with HHLA2, it costimulates T-cells in the context of TCR-mediated activation and enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade (PMID: 22419821; 23784006). TMIGD2 has been associated with several diseases, particularly in the context of cancer. It is aberrantly expressed by human AML cells and can be used to identify and enrich functional LSCs (PMID: 38167704). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2264 Product name: Recombinant Human TMIGD2/CD28H protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-150 aa of BC015655 Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG Predict reactive species Full Name: transmembrane and immunoglobulin domain containing 2 Calculated Molecular Weight: 282 aa, 31 kDa GenBank Accession Number: BC015655 Gene Symbol: TMIGD2 Gene ID (NCBI): 126259 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96BF3 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.