Proteintech, 98296-2-RR, Anti-Human RANK/TNFRSF11A Rabbit Recombinant Antibody

Size: 100ug The RANK/TNFRSF11A (98296-2-RR) by Proteintech is a Recombinant antibody targeting RANK/TNFRSF11A in FC applications with reactivity to human samples 98296-2-RR targets RANK/TNFRSF11A in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected CHO cells, K-562 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A, also known as RANK, CD265, and ODFR) is the signaling receptor essential for osteoclast differentiation factor-mediated osteoclastogenesis and is involved in the regulation of interactions between T-cells and dendritic cells (PMID: 9878548). The RANK/RANKL/OPG system is a key regulator in bone resorption, and its dysregulation can lead to pathological bone loss (PMID: 37893470). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3521 Product name: Recombinant Human RANK/TNFRSF11A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-212 aa of NM_003839 Sequence: IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 11a, NFKB activator Calculated Molecular Weight: 66 kDa GenBank Accession Number: NM_003839 Gene Symbol: TNFRSF11A Gene ID (NCBI): 8792 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6Q6 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.