Proteintech, 98315-4-RR, Anti-Mouse CD107b / LAMP2 Rabbit Recombinant Antibody

Size: 100ug The CD107b / LAMP2 (98315-4-RR) by Proteintech is a Recombinant antibody targeting CD107b / LAMP2 in FC(intra) applications with reactivity to mouse samples 98315-4-RR targets CD107b / LAMP2 in FC(intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC(intra) detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC)(INTRA): FC(INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LAMP2 (CD107b) is a Lysosomal membrane glycoprotein. LAMP2 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP-2 is localized primarily in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane under certain circumstances, e.g., after platelet activation, during granulocytic differentiation and activation, and in some tumor cells (PMID: 12221139). LAMP is involved in lysosomal stability and autophagy (PMID: 12221139). This glycoprotein provides selectins with carbohydrate ligands. LAMP2 may plays a role in tumor cell metastasis (PMID 9426697). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2029 Product name: Recombinant Mouse CD107b/LAMP2 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-379 aa of NM_001017959.2 Sequence: LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDN Predict reactive species Full Name: lysosomal-associated membrane protein 2 Calculated Molecular Weight: 46 kDa GenBank Accession Number: NM_001017959.2 Gene Symbol: CD107b / LAMP2 Gene ID (NCBI): 16784 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17047-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.