Proteintech, 98331-2-RR, Anti-Mouse APRIL/TNFSF13 Rabbit Recombinant Antibody

Size: 100ug The APRIL/TNFSF13 (98331-2-RR) by Proteintech is a Recombinant antibody targeting APRIL/TNFSF13 in FC (Intra) applications with reactivity to mouse samples 98331-2-RR targets APRIL/TNFSF13 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information TNFSF13 gene encodes tumor necrosis factor ligand superfamily member 13 (or APRIL) belonging to the tumor necrosis factor (TNF) family. APRIL is highly expressed in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages, and its precursor is cleaved by furin. APRIL may be implicated in the regulation of tumor cell growth and also monocyte/macrophage-mediated immunological processes. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1561 Product name: Recombinant Mouse APRIL/TNFSF13 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 96-241 aa of NM_023517.2 Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 13 Calculated Molecular Weight: 27kDa GenBank Accession Number: NM_023517.2 Gene Symbol: Tnfsf13 Gene ID (NCBI): 69583 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9D777 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.