Iright
BRAND / VENDOR: Proteintech

Proteintech, 98353-4-RR, Anti-Mouse CXCR2 Rabbit Recombinant Antibody

CATALOG NUMBER: 98353-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CXCR2 (98353-4-RR) by Proteintech is a Recombinant antibody targeting CXCR2 in FC applications with reactivity to mouse samples 98353-4-RR targets CXCR2 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CXCR2, also named as CD182, Cmkar2, Gpcr16, or Il8rb, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8, which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2228 Product name: Recombinant Mouse CXCR2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-47 aa of NM_009909.3 Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS Predict reactive species Full Name: interleukin 8 receptor, beta Calculated Molecular Weight: 40 kDa GenBank Accession Number: NM_009909.3 Gene Symbol: Cxcr2 Gene ID (NCBI): 12765 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35343 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924