Iright
BRAND / VENDOR: Proteintech

Proteintech, 98361-3-RR, Anti-Rat MMP8 Rabbit Recombinant Antibody

CATALOG NUMBER: 98361-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The MMP8 (98361-3-RR) by Proteintech is a Recombinant antibody targeting MMP8 in FC (Intra) applications with reactivity to rat samples 98361-3-RR targets MMP8 in FC (Intra) applications and shows reactivity with rat samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information MMP8(Matrix metalloproteinase-8) an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells(PMID:15367487). Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3278 Product name: Recombinant Rat MMP-8 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-466 aa of NM_022221.1 Sequence: LPVPPEHLEEKNMKTAENYLRKFYHLPSNQFRSARNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTPTACDPHLRFDAATTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPGINCRIDAVFQQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP Predict reactive species Full Name: matrix metallopeptidase 8 Calculated Molecular Weight: 53 kDa GenBank Accession Number: NM_022221.1 Gene Symbol: Mmp8 Gene ID (NCBI): 63849 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O88766 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924