Proteintech, 98388-1-RR, Anti-Mouse IL-28A Rabbit Recombinant Antibody

Size: 100ug The IL-28A (98388-1-RR) by Proteintech is a Recombinant antibody targeting IL-28A in FC applications with reactivity to mouse samples 98388-1-RR targets IL-28A in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3169 Product name: Recombinant Mouse IL-28A protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-193 aa of NM_001024673.2 Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV Predict reactive species Full Name: interleukin 28A Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_001024673.2 Gene Symbol: Il28a Gene ID (NCBI): 330496 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q4VK74 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.