Proteintech, 98395-1-RR, Anti-Mouse CLEC9A/CD370 Rabbit Recombinant Antibody

Size: 100ug The CLEC9A/CD370 (98395-1-RR) by Proteintech is a Recombinant antibody targeting CLEC9A/CD370 in FC applications with reactivity to mouse samples 98395-1-RR targets CLEC9A/CD370 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CLEC9A (C-type lectin domain family 9 member A), also known as DNGR1, CD370, is a type II membrane protein that contains C-type lectin domain. The C-type lectin domain family members share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. Mouse Clec9A is primarily restricted to dendritic cells (DCs) and selectively expressed in mouse CD8+ conventional DCs (cDCs) and plasmacytoid DCs (pDCs), whereas human CLEC9A is also expressed on human DC subtypes. CLEC9A functions as an activating receptor that recruits Syk kinase and can induce the production of proinflammatory cytokines. (PMID: 25553393; PMID: 15476922; PMID: 18669894; PMID: 18408006) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2730 Product name: Recombinant Mouse Clec9a protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 57-264 aa of NM_001205363.1 Sequence: KFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGTDASTGPVLLTSPQMVPQTLDSKETGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI Predict reactive species Full Name: C-type lectin domain family 9, member a Calculated Molecular Weight: 30 kDa GenBank Accession Number: NM_001205363.1 Gene Symbol: Clec9a Gene ID (NCBI): 232414 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8BRU4-4 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.