Iright
BRAND / VENDOR: Proteintech

Proteintech, 98399-1-RR, Anti-Mouse SDC2 Rabbit Recombinant Antibody

CATALOG NUMBER: 98399-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The SDC2 (98399-1-RR) by Proteintech is a Recombinant antibody targeting SDC2 in FC applications with reactivity to mouse samples 98399-1-RR targets SDC2 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2700 Product name: Recombinant Mouse SDC2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-145 aa of NM_008304.2 Sequence: ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTE Predict reactive species Full Name: syndecan 2 Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_008304.2 Gene Symbol: SDC2 Gene ID (NCBI): 15529 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43407 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924