Proteintech, 98406-2-RR, Anti-Mouse IL-15RA Rabbit Recombinant Antibody

Size: 100ug The IL-15RA (98406-2-RR) by Proteintech is a Recombinant antibody targeting IL-15RA in FC applications with reactivity to mouse samples 98406-2-RR targets IL-15RA in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-15 (IL-15) is a pleiotropic cytokine that plays an important role in both innate and adaptive immunity. IL-15 is mainly produced by activated monocytes, macrophages and dendritic cells, and is structurally similar to IL-2 (PMID: 8178155; 12401478). These two cytokines share the same IL-2/15Rβ and common γ-chain receptor subunits. In addition, IL-2 and IL-15 have their own private α-chain receptor subunit, IL-2Rα and IL-15Rα, respectively (PMID: 7641685). The IL-15Rα chain is expressed by many cell types including monocytes, DCs, NK, T cells and fibroblasts. Several isoforms of IL-15Rα exist and are generated either by alternative splicing or by proteolytic cleavage (PMID: 10480910; 15265897). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2687 Product name: Recombinant Mouse IL-15RA protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-205 aa of NM_008358.2 Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK Predict reactive species Full Name: interleukin 15 receptor, alpha chain Calculated Molecular Weight: 28 kDa GenBank Accession Number: NM_008358.2 Gene Symbol: Il15ra Gene ID (NCBI): 16169 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q60819-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.