Proteintech, 98409-2-RR, Anti-Mouse CD134/OX40 Rabbit Recombinant Antibody

Size: 100ug The CD134/OX40 (98409-2-RR) by Proteintech is a Recombinant antibody targeting CD134/OX40 in FC applications with reactivity to mouse samples 98409-2-RR targets CD134/OX40 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: CD3/CD28 treated BALB/c mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2936 Product name: Recombinant Mouse CD134/OX40 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-211 aa of NM_011659.2 Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 4 Calculated Molecular Weight: 30 kDa GenBank Accession Number: NM_011659.2 Gene Symbol: CD134 Gene ID (NCBI): 22163 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P47741 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.