Iright
BRAND / VENDOR: Proteintech

Proteintech, 98419-3-RR, Anti-Mouse CD164 Rabbit Recombinant Antibody

CATALOG NUMBER: 98419-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD164 (98419-3-RR) by Proteintech is a Recombinant antibody targeting CD164 in FC applications with reactivity to mouse samples 98419-3-RR targets CD164 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2645 Product name: Recombinant Mouse CD164 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-162 aa of NM_016898.2 Sequence: QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD Predict reactive species Full Name: CD164 antigen Calculated Molecular Weight: 21 kDa GenBank Accession Number: NM_016898.2 Gene Symbol: Cd164 Gene ID (NCBI): 53599 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9R0L9 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924