Iright
BRAND / VENDOR: Proteintech

Proteintech, 98421-4-RR, Anti-Mouse IL-27 p28 Rabbit Recombinant Antibody

CATALOG NUMBER: 98421-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-27 p28 (98421-4-RR) by Proteintech is a Recombinant antibody targeting IL-27 p28 in FC (Intra) applications with reactivity to mouse samples 98421-4-RR targets IL-27 p28 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated RAW264.7 cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-27, as a member of the IL-6/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0897 Product name: Recombinant Mouse IL-27A protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-234 aa of Sequence: FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS Predict reactive species Full Name: interleukin 27 Gene Symbol: Il27 Gene ID (NCBI): 246779 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O35228(IL27B)+Q8K3I6(IL27A) Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924