Proteintech, 98425-3-RR, Anti-Mouse CD74 Rabbit Recombinant Antibody

Size: 100ug The CD74 (98425-3-RR) by Proteintech is a Recombinant antibody targeting CD74 in FC applications with reactivity to mouse samples 98425-3-RR targets CD74 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165; PMID: 36712241). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2716 Product name: Recombinant Mouse Cd74 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 56-279 aa of NM_001042605.1 Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL Predict reactive species Full Name: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) Calculated Molecular Weight: 32 kDa GenBank Accession Number: NM_001042605.1 Gene Symbol: Cd74 Gene ID (NCBI): 16149 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04441-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.