Product Description
Size: 100ug
The CCL11/Eotaxin (98464-1-RR) by Proteintech is a Recombinant antibody targeting CCL11/Eotaxin in FC (Intra) applications with reactivity to mouse samples
98464-1-RR targets CCL11/Eotaxin in FC (Intra) applications and shows reactivity with mouse samples.
Tested Applications
Positive FC (Intra) detected in: Transfected HEK-293T cells
Recommended dilution
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
CCL11 also named Eotaxin-1, was initially discovered as an eosinophil-specific chemoattractant. CCL11 plays a central role in both allergic and non-allergic inflammatory reactions by recruiting immune cells such as eosinophils,basophils and Th2 lymphocytes. CCL11 binds to the chemokine receptors CCR2, CCR3 and CCR5, with highest affinity to CCR3. High levels of CCL11 have been described in several chronic inflammatory diseases, such as allergic rhinitis, atopic dermatitis, asthma, gastrointestinal disease and rheumatoid arthritis.
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg2400 Product name: recombinant mouse Ccl11 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_011330 Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP Predict reactive species
Full Name: chemokine (C-C motif) ligand 11
Calculated Molecular Weight: 11kd
GenBank Accession Number: NM_011330
Gene Symbol: Ccl11
Gene ID (NCBI): 20292
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P48298
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924