Iright
BRAND / VENDOR: Proteintech

Proteintech, 98504-1-RR, Anti-Human IL-29 Rabbit Recombinant Antibody

CATALOG NUMBER: 98504-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-29 (98504-1-RR) by Proteintech is a Recombinant antibody targeting IL-29 in FC (Intra) applications with reactivity to human samples 98504-1-RR targets IL-29 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2843 Product name: Recombinant Human IL29 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-200 aa of NM_172140.1 Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST Predict reactive species Full Name: interleukin 29 (interferon, lambda 1) Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_172140.1 Gene Symbol: IL-29 Gene ID (NCBI): 282618 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IU54 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924