Iright
BRAND / VENDOR: Proteintech

Proteintech, 98535-1-RR, Anti-Mouse IL-16 Rabbit Recombinant Antibody

CATALOG NUMBER: 98535-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-16 (98535-1-RR) by Proteintech is a Recombinant antibody targeting IL-16 in FC (Intra) applications with reactivity to mouse samples 98535-1-RR targets IL-16 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3127 Product name: Recombinant Mouse IL-16 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1205-1322 aa of NM_010551.3 Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS Predict reactive species Full Name: interleukin 16 Calculated Molecular Weight: 141 kDa GenBank Accession Number: NM_010551.3 Gene Symbol: Il16 Gene ID (NCBI): 16170 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O54824-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924