Iright
BRAND / VENDOR: Proteintech

Proteintech, 98543-1-RR, Anti-Mouse 4-1BBL/TNFSF9 Rabbit Recombinant Antibody

CATALOG NUMBER: 98543-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The 4-1BBL/TNFSF9 (98543-1-RR) by Proteintech is a Recombinant antibody targeting 4-1BBL/TNFSF9 in FC applications with reactivity to mouse samples 98543-1-RR targets 4-1BBL/TNFSF9 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: RAW 264.7 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2641 Product name: Recombinant Mouse TNFSF9 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 139-309 aa of NM_009404.3 Sequence: NTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 9 Calculated Molecular Weight: 34 kDa GenBank Accession Number: NM_009404.3 Gene Symbol: Tnfsf9 Gene ID (NCBI): 21950 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41274 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924