Proteintech, 98552-2-RR, Anti-Rat B7-H4 Rabbit Recombinant Antibody

Size: 100ug The B7-H4 (98552-2-RR) by Proteintech is a Recombinant antibody targeting B7-H4 in FC applications with reactivity to rat samples 98552-2-RR targets B7-H4 in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information B7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3230 Product name: Recombinant Rat B7-H4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-257 aa of NM_001024244.1 Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG Predict reactive species Full Name: V-set domain containing T cell activation inhibitor 1 Calculated Molecular Weight: 31 kDa GenBank Accession Number: NM_001024244.1 Gene Symbol: Vtcn1 Gene ID (NCBI): 295322 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q501W4 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.