Iright
BRAND / VENDOR: Proteintech

Proteintech, 98554-1-RR, Anti-Human CCL14 Rabbit Recombinant Antibody

CATALOG NUMBER: 98554-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CCL14 (98554-1-RR) by Proteintech is a Recombinant antibody targeting CCL14 in FC (Intra) applications with reactivity to human samples 98554-1-RR targets CCL14 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CCL14, also known as HCC-1, is a human plasma chemokine that belongs to the CC chemokine family. It was originally collected and purified from the hemofiltrate of patients with chronic renal failure. CCL14 is constitutively expressed in various tissues, including the spleen, bone marrow, liver, muscle, and intestine. CCL14 serves as a novel prognostic factor and tumor suppressor of HCC by modulating cell cycle and promoting apoptosis (PMID: 31641099), and CCL14 is a potential biomarker associated with immune cell infiltration in lung adenocarcinoma (PMID: 39030403). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2879 Product name: Recombinant Human CCL14 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-93 aa of NM_032963.3 Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN Predict reactive species Full Name: chemokine (C-C motif) ligand 14 Calculated Molecular Weight: 11k kDa GenBank Accession Number: NM_032963.3 Gene Symbol: CCL14 Gene ID (NCBI): 6358 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16627-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924