Product Description
Size: 100ug
The CD8b (98585-1-RR) by Proteintech is a Recombinant antibody targeting CD8b in FC applications with reactivity to guinea pig samples
98585-1-RR targets CD8b in FC applications and shows reactivity with guinea pig samples.
Tested Applications
Positive FC detected in: guinea pig splenocytes
Recommended dilution
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on the surface of cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells.
Specification
Tested Reactivity: guinea pig
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg7177 Product name: Recombinant guinea pig CD8B protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-168 aa of NM_001172877.1 Sequence: LQQSPHFLMLQTNQSATMTCESKTSSINGRLYWLRQRGAPSPDSHHEFLASGDFSNNIVYGRGMTSEMLTLSRLSTRFTLSLKHVKPEDSGVYFCMTIGHPELTFGMGTNLSVVDVLPTTAQPTTKTTPKKKKCQPPSPGPQKGLHC Predict reactive species
Full Name: CD8 subunit beta
Calculated Molecular Weight: 23 kDa
GenBank Accession Number: NM_001172877.1
Gene Symbol: Cd8b
Gene ID (NCBI): 100379572
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q6W8W7
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924