Iright
BRAND / VENDOR: Proteintech

Proteintech, 98587-2-RR, Anti-Mouse RON/MST1R Rabbit Recombinant Antibody

CATALOG NUMBER: 98587-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The RON/MST1R (98587-2-RR) by Proteintech is a Recombinant antibody targeting RON/MST1R in FC applications with reactivity to mouse samples 98587-2-RR targets RON/MST1R in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse peritoneal macrophages Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information RON (also referred to as MST1R, or CD136) is a receptor tyrosine kinase that belongs to the MET proto-oncogene family. The precursor RON is produced as a glycosylated, single chain that is cleaved into a 185-kDa heterodimer of α (35 kDa) and β (150 kDa) subunits connected by a disulfide bond (PMID: 8062829). It is activated upon binding to its ligand, macrophage-stimulating protein (MSP, also known as MST1 and HGFL). RON signalling is essential for embryonic development and regulates many physiological processes including cell survival, migration and differentiation. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2647 Product name: Recombinant Mouse MST1R protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-960 aa of NM_009074.2 Sequence: TNLNWQCPRIPYAASRDFSVKYVVPSFSAGGRVQATAAYEDSTNSAVFVATRNHLHVLGPDLQFIENLTTGPIGNPGCQTCASCGPGPHGPPKDTDTLVLVMEPGLPALVSCGSTLQGRCFLHELEPRGKALHLAAPACLFSANNNKPEACTDCVASPLGTRVTVVEQGHASYFYVASSLDPELAASFSPRSVSIRRLKSDTSGFQPGFPSLSVLPKYLASYLIKYVYSFHSGDFVYFLTVQPISVTSPPSALHTRLVRLNAVEPEIGDYRELVLDCHFAPKRRRRGAPEGTQPYPVLQAAHSAPVDAKLAVELSISEGQEVLFGVFVTVKDGGSGMGPNSVVCAFPIYHLNILIEEGVEYCCHSSNSSSLLSRGLDFFQTPSFCPNPPGGEASGPSSRCHYFPLMVHASFTRVDLFNGLLGSVKVTALHVTRLGNVTVAHMGTVDGRVLQVEIARSLNYLLYVSNFSLGSSGQPVHRDVSRLGNDLLFASGDQVFKVPIQGPGCRHFLTCWRCLRAQRFMGCGWCGDRCDRQKECPGSWQQDHCPPEISEFYPHSGPLRGTTRLTLCGSNFYLRPDDVVPEGTHQITVGQSPCRLLPKDSSSPRPGSLKEFIQELECELEPLVTQAVGTTNISLVITNMPAGKHFRVEGISVQEGFSFVEPVLTSIKPDFGPRAGGTYLTLEGQSLSVGTSRAVLVNGTQCRLEQVNEEQILCVTPPGAGTARVPLHLQIGGAEVPGSWTFHYKEDPIVLDISPKCGYSGSHIMIHGQHLTSAWHFTLSFHDGQSTVESRCAGQFVEQQQRRCRLPEYVVRNPQGWATGNLSVWGDGAAGFTLPGFRFLPPPSPLRAGLVELKPEEHSVKVEYVGLGAVADCVTVNMTVGGEVCQHELRGDVVICPLPPSLQLGKDGVPLQVCVDGGCHILSQVVRSSPGRASQR Predict reactive species Full Name: macrophage stimulating 1 receptor (c-met-related tyrosine kinase) Calculated Molecular Weight: 151 kDa GenBank Accession Number: NM_009074.2 Gene Symbol: Mst1r Gene ID (NCBI): 19882 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q62190-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924