Proteintech, 98589-1-RR, Anti-Human ATP1B3 Rabbit Recombinant Antibody

Size: 100ug The ATP1B3 (98589-1-RR) by Proteintech is a Recombinant antibody targeting ATP1B3 in FC applications with reactivity to human samples 98589-1-RR targets ATP1B3 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: FC receptor blocked human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ATP1B3 (also known as CD298) is the β3 subunit of Na+/K+-ATPase which functions to maintain sodium and potassium gradients across membranes involved in cellular activities. ATP1B3 is a glycosylated protein and there are fully and intermediately glycosylated forms of ATP1B3 in mammalian cells. The predicted MW of ATP1B3 is around 32 kDa, while various forms (38-43 kDa) can be observed due to the different level of glycosylation (PMID: 30792309, 16339171, 17176442). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4947 Product name: Recombinant Human ATP1B3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 57-279 aa of BC011835 Sequence: TMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA Predict reactive species Full Name: ATPase, Na+/K+ transporting, beta 3 polypeptide Calculated Molecular Weight: 32 kDa GenBank Accession Number: BC011835 Gene Symbol: ATP1B3 Gene ID (NCBI): 483 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54709 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.