Iright
BRAND / VENDOR: Proteintech

Proteintech, 98601-2-RR, Anti-Human CD32 Rabbit Recombinant Antibody

CATALOG NUMBER: 98601-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD32 (98601-2-RR) by Proteintech is a Recombinant antibody targeting CD32 in FC applications with reactivity to human samples 98601-2-RR targets CD32 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood lymphocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2713 Product name: Recombinant Human FCGR2A/CD32a protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 34-217 aa of NM_001136219.3 Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG Predict reactive species Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32) Calculated Molecular Weight: 35 kDa GenBank Accession Number: NM_001136219.3 Gene Symbol: CD32a Gene ID (NCBI): 2212 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12318-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924